Recombinant Rat IFN-gamma Protein
Produktgrößen
10 ug
£133,00
RP01075-10UG
20 ug
£181,00
RP01075-20UG
50 ug
£240,00
RP01075-50UG
100 ug
£353,00
RP01075-100UG
500 ug
£1240,00
RP01075-500UG
1000 ug
£1954,00
RP01075-1000UG
Über dieses Produkt
- SKU:
- RP01075
- Zusätzliche Namen:
- IFN-gamma,Interferon Gamma,IFNG
- Weitere Details:
- Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
- Formulierung:
- Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat Interferon Gamma (Accession #NP_620235.1) fused wit
- Immunogen:
- Gln23-Cys156
- Molekulargewicht:
- 50-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01075
