Recombinant Human IL-1R1/CD121a Protein
Produktgrößen
10 ug
£133,00
RP01036-10UG
20 ug
£181,00
RP01036-20UG
50 ug
£240,00
RP01036-50UG
100 ug
£353,00
RP01036-100UG
500 ug
£1002,00
RP01036-500UG
1000 ug
£1574,00
RP01036-1000UG
Über dieses Produkt
- SKU:
- RP01036
- Zusätzliche Namen:
- IL1R1,CD121A,D2S1473,IL-1R-alpha,IL1R,IL1RA,P80
- Weitere Details:
- Interleukin 1 receptor, type I (IL-1R1) also known as CD121a (Cluster of Differentiation 121a), is an interleukin receptor. The protein encoded by this gene is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA). The shape change and subsequent repair processes are IL-1B Beta activity-dependent, acting through the IL-1 type 1 receptor (IL-1R1), as co-application of the IL-1type 1 receptor antagonist protein (IL-1ra) blocks IL-1B Beta induced effects. This gene along with interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 2 (IL1RL2), and interleukin 1 receptor-like 1 (IL1RL1) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. It has been suggested that the Type II receptor, either as the membrane-bound or as the soluble form, serves as a decoy for IL-1 and inhibits IL-1 action by blocking the binding of IL-1 to the signaling Type I receptor complex. Recombinant IL-1 soluble receptor Type I is a potent antagonist of IL-1 action.
- Formulierung:
- Recombinant Human IL-1R1/CD121a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp21-Thr332) of human IL1R1 (Accession #NP_000868.1) fused with a
- Immunogen:
- Asp21-Thr332
- Molekulargewicht:
- Approximately 55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01036

