Recombinant Human Cystatin-D/CST5 Protein
Produktgrößen
10 ug
£193,00
RP01035-10UG
20 ug
£258,00
RP01035-20UG
50 ug
£383,00
RP01035-50UG
100 ug
£586,00
RP01035-100UG
500 ug
£1716,00
RP01035-500UG
1000 ug
£2716,00
RP01035-1000UG
Über dieses Produkt
- SKU:
- RP01035
- Zusätzliche Namen:
- CST5,MGC71922,CST5
- Weitere Details:
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Cystatins are natural inhibitors of papain-like (family C1) and legumain-related (family C13) cysteine peptidases. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. As a member of type 2 cystatin, cystatin D is a single-domain protein and also has cysteine residues that form disulfide bridges. The functions of Cystatin D are largely unknown. However, Cystatin D has been shown to inhibit coronavirus replication at its physiological concentration (0.12_x005f
- Formulierung:
- Recombinant Human Cystatin-D/CST5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Val142) of human Cystatin D (Accession #NP_001891.2) fused
- Immunogen:
- Gly21-Val142
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01035
