Recombinant Human IFN-lambda 1/IL-29 Protein
Produktgrößen
10 ug
£127,00
RP00977-10UG
20 ug
£175,00
RP00977-20UG
50 ug
£240,00
RP00977-50UG
100 ug
£336,00
RP00977-100UG
500 ug
£1002,00
RP00977-500UG
1000 ug
£1574,00
RP00977-1000UG
Über dieses Produkt
- SKU:
- RP00977
- Zusätzliche Namen:
- IFNL1,IL-29,IL29
- Weitere Details:
- This protein is also known as cytokine Zcyto21, Interferon lambda-1, IFN-lambda-1, and IFNL1, is a secreted protein which belongs to the IL-28 / IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-1 receptor beta (IL-1Rbeta) and an orphan class II receptor chain, designated IL-28Ralpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL1RB and IL28RA. The ligand / receptor complex seems to signal through the Jak-STAT pathway.
- Formulierung:
- Recombinant Human IFN-lambda 1/IL-29 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly20-Thr200) of human IL-29 (Accession #NP_742152.1) fused with a
- Immunogen:
- Gly20-Thr200
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00977