Recombinant Human LR3-IGF-1(E51R) Protein
Produktgrößen
50 ug
£115,00
RP00825-50UG
100 ug
£145,00
RP00825-100UG
500 ug
£354,00
RP00825-500UG
1000 ug
£509,00
RP00825-1000UG
Über dieses Produkt
- SKU:
- RP00825
- Zusätzliche Namen:
- IGF1, IBP1, IGF-1,Insulin-like growth factor 1, Insulin-like growth factor I, IGF-I, Mechano growth factor, MGF, Somatomedin-C
- Weitere Details:
- Long R3 IGF-1 (LR3 IGF-1) is a synthetic analog of IGF-1 that is generated by modifying the AA sequence for mature human IGF-1. These modifications include the substitution of an Arg for Glu at position three of the mature IGF-1 sequence and the addition of a thirteen aa N-terminal extension, which is derived from methionyl porcine Growth Hormone. These aa changes generate a protein that is still capable of binding to IGF-1 and Insulin receptors, but shows considerably lower affinity binding to IGFBPs compared to wild-type IGF-1. As a result, LR3 IGF-1 has an increased half-life and displays increased biological potency compared to IGF-1.
- Formulierung:
- Recombinant Human LR3-IGF-1(E51R) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly49-Ala118) of human IGF-1 (Accession #P05019) with the substitutio
- Immunogen:
- MFPAMPLSSLFVNGly49-Ala118 (Glu51Arg)
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00825
