Recombinant Human TMIGD2/CD28H Protein
Produktgrößen
10 ug
£193,00
RP00809-10UG
50 ug
£478,00
RP00809-50UG
500 ug
£2192,00
RP00809-500UG
Über dieses Produkt
- SKU:
- RP00809
- Zusätzliche Namen:
- Transmembrane and immunoglobulin domain-containing protein 2, Immunoglobulin and proline-rich receptor 1, IGPR1, TMIGD2
- Weitere Details:
- TMIGD2 is a single-pass type I membrane protein, which contains one Ig-like (immunoglobulin-like) domain. Itis widely expressed in many tissues, such as epithelial, endothelial cells and lung. However, it isn't detected inthyroid, cerebellum, thymus and cerebral cortex. TMIGD2 can form homophilic interactions that could regulatecell-cell interaction. It Interacts with CACNB2, DST, MIA and NCKIPSD. It is shown that TMIGD2 plays a role incell-cell interaction, cell migration, and angiogenesis.
- Formulierung:
- Recombinant Human TMIGD2/CD28H Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu23-Gly150) of human TMIGD2/IGPR1 (Accession #Q96BF3) fused with a
- Immunogen:
- Leu23-Gly150
- Molekulargewicht:
- 20-30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00809
