Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein
Produktgrößen
10 ug
£145,00
RP00805-10UG
50 ug
£336,00
RP00805-50UG
500 ug
£1478,00
RP00805-500UG
1000 ug
£2430,00
RP00805-1000UG
Über dieses Produkt
- SKU:
- RP00805
- Zusätzliche Namen:
- TNFRSF10C,CD263,DCR1,DCR1-TNFR,LIT,TRAIL-R3,TRAILR3,TRID
- Weitere Details:
- Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membraneprotein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks theintracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn ' t transduce an apoptosis signal. Theexpression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-inducedapoptosis.
- Formulierung:
- Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala26-Ala221) of human TNFRSF10C/DcR1/TRAIL-R3/CD26
- Immunogen:
- Ala26-Ala221
- Molekulargewicht:
- 38-58 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00805
