Recombinant Mouse CCL8/MCP-2 Protein
Produktgrößen
10 ug
£145,00
RP00773-10UG
20 ug
£193,00
RP00773-20UG
50 ug
£288,00
RP00773-50UG
100 ug
£431,00
RP00773-100UG
500 ug
£1716,00
RP00773-500UG
1000 ug
£2716,00
RP00773-1000UG
Über dieses Produkt
- SKU:
- RP00773
- Zusätzliche Namen:
- C-C motif chemokine 8|Ccl8|MCP-2|Mcp2|Monocyte chemoattractant protein 2|Monocyte chemotactic protein2|Scya8|Small-inducible cytokine A8
- Weitere Details:
- Chemokine ligand 8 (CCL8,MCP-2), is a small secreted cytokine which belongs to the intercrine beta(chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions toactivate different immune cells, including mast cells, eosinophils and basophils which are involved in allergicresponses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its abilityachieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B andCCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is oneof the major co-receptors for HIV-1.
- Formulierung:
- Recombinant Mouse CCL8/MCP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gly24-Pro97) of mouse CCL8/MCP-2 (Accession #Q9Z121) fused with a 6xHis tag
- Immunogen:
- Gly24-Pro97
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00773