Recombinant Mouse TNFSF9/4-1BB Ligand Protein
Produktgrößen
10 ug
£145,00
RP00766-10UG
20 ug
£193,00
RP00766-20UG
50 ug
£288,00
RP00766-50UG
100 ug
£431,00
RP00766-100UG
500 ug
£1240,00
RP00766-500UG
1000 ug
£1954,00
RP00766-1000UG
Über dieses Produkt
- SKU:
- RP00766
- Zusätzliche Namen:
- Tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, 4-1BBL, Tnfsf9, Cd137l,Cd157l, Ly63l, TNFSF9
- Weitere Details:
- Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumornecrosis factor family. Mouse 4-1BBL cDNA encodes a 309 amino acid residues (aa) protein with an 82 aa N-terminal cytoplasmic domain, a 21 aa transmembrane domain and a 206 aa C-terminal extracellular domain.The extracellular domain of 4-1BBL has a tertiary structure similar to that of other TNFSF members, but sharesonly low aa sequence homology (14-16%). 4-1BBL is predominantly expressed on activated antigen presentingcells (APCs) such as B cells, macrophages and dendritic cells (DCs). It is also expressed on most T and Blymphoma cell lines. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting Tlymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses inCD8 T cells, and is thought to be involved in T cell-tumor cell interaction.
- Formulierung:
- Recombinant Mouse TNFSF9/4-1BB Ligand Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg104-Glu309) of mouse TNFSF9/4-1BB Ligand (Accession #P4127
- Immunogen:
- Arg104-Glu309
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00766