Recombinant Mouse Fc-gamma RIII/CD16 Protein
Produktgrößen
10 ug
£145,00
RP00761-10UG
50 ug
£336,00
RP00761-50UG
500 ug
£2050,00
RP00761-500UG
1000 ug
£2430,00
RP00761-1000UG
Über dieses Produkt
- SKU:
- RP00761
- Zusätzliche Namen:
- CD-antigen 16|CD16|Fc gamma Receptor III|Fcgr3|FcRIII|IgG Fc receptor III|Low affinity immunoglobulin gamma Fc region receptor III
- Weitere Details:
- Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Igsuperfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been dividedinto three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Eachgroup may be encoded by multiple genes and exist in different isoforms depending on species and cell type.Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting ofimmunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a varietyof myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligandbinding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependentcellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of typeI/IIa/III hypersensitivity.
- Formulierung:
- Recombinant Mouse Fc-gamma RIII/CD16 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala31-Thr215) of mouse Fc G Gamma RIIIA/FCGR3/CD16 (Accession
- Immunogen:
- Ala31-Thr215
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00761
