Recombinant Mouse TNFRSF6/FAS/CD95 Protein
Produktgrößen
10 ug
£145,00
RP00737-10UG
50 ug
£336,00
RP00737-50UG
500 ug
£2050,00
RP00737-500UG
1000 ug
£2430,00
RP00737-1000UG
Über dieses Produkt
- SKU:
- RP00737
- Zusätzliche Namen:
- Apo-1 antigen|Apoptosis-mediatingsurface antigen FAS|CD95|Fas|FASLG receptor|TNFRSF6|Tumor necrosis factor receptor superfamily member 6
- Weitere Details:
- Mouse Apoptosis-mediating surface antigen FAS (Fas) belongs to the death receptor subfamily of the TNFreceptor superfamily and is designated TNFRSF6. Mouse Fas contains 1 death domain and 3 TNFR-Cys repeats.It detected in various tissues including thymus, liver, lung, heart, and adult ovary. As a receptor forTNFSF6/FASLG, The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequentcascade of caspases mediating apoptosis. FAS-mediated apoptosis may have a role in the induction ofperipheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
- Formulierung:
- Recombinant Mouse TNFRSF6/FAS/CD95 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln22-Arg169) of Mouse TNFRSF6/FAS/CD95 (Accession #P25446 ) fus
- Immunogen:
- Gln22-Arg169
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00737
