Recombinant Mouse CCL3/MIP-1 alpha Protein
Produktgrößen
10 ug
£145,00
RP00714-10UG
20 ug
£193,00
RP00714-20UG
50 ug
£288,00
RP00714-50UG
500 ug
£1240,00
RP00714-500UG
1000 ug
£1954,00
RP00714-1000UG
Über dieses Produkt
- SKU:
- RP00714
- Zusätzliche Namen:
- Ccl3, Mip1a, Scya3, C-C motif chemokine 3,MIP-1-alpha, SIS-alpha
- Weitere Details:
- Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)
- Formulierung:
- Recombinant Mouse CCL3/MIP-1 alpha Protein is produced by CHO cells expression system. The target protein is expressed with sequence (Ala24-Ala92) of Mouse CCL3/MIP-1 alpha (Accession # NP_035467.1) f
- Immunogen:
- Ala24-Ala92
- Molekulargewicht:
- 10.8 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00714
