Recombinant Human IL-12 R beta 1/CD212 Protein
Produktgrößen
10 ug
£145,00
RP00675-10UG
50 ug
£336,00
RP00675-50UG
500 ug
£2050,00
RP00675-500UG
1000 ug
£2430,00
RP00675-1000UG
Über dieses Produkt
- SKU:
- RP00675
- Zusätzliche Namen:
- IL12RB1,CD212,IL-12R-BETA1,IL12RB,IMD30
- Weitere Details:
- Interleukin12 receptor subunit beta 1 (IL12RB1) is a type I transmembrane protein that belongs to thehemopoietin receptor superfamily. IL12RB1 can spontaneously form homodimers and -oligomers, which areable to bind IL12 with only low affinity. IL12 high affinity receptor complex is composed of two subunitsdesignated IL12RB1 and IL12RB2. While IL12RB1 interacts with the IL-12p40 subunit, IL-12p35 is mainlyconnecting with IL12RB2. This receptor chain is also responsible for transmitting the IL12 signal into the cell.IL12RB1, to the contrary, is also part of the IL23R, where it interacts with the p40 subunit of IL23. IL12RB1 isexpressed in activated T cells, NK cells and B cells.
- Formulierung:
- Recombinant Human IL-12 R beta 1/CD212 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Cys24-Glu540) of Human IL-12 R beta 1/CD212 (Accession #P427
- Immunogen:
- Cys24-Glu540
- Molekulargewicht:
- 95-110 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00675
