Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein
Produktgrößen
10 ug
£193,00
RP00666-10UG
20 ug
£258,00
RP00666-20UG
50 ug
£383,00
RP00666-50UG
100 ug
£586,00
RP00666-100UG
500 ug
£1764,00
RP00666-500UG
1000 ug
£2716,00
RP00666-1000UG
Über dieses Produkt
- SKU:
- RP00666
- Zusätzliche Namen:
- IL-1ra, F630041P17Rik,IL1RN
- Weitere Details:
- Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of theinterleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouseIl1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26%and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity ofinterleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP forsignaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in thetreatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.
- Formulierung:
- Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg27-Gln178) of mouse IL-1Ra/IL-1F3/IL-1RN (Accession #P25085)
- Immunogen:
- Arg27-Gln178
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00666
