Biotinylated Recombinant Human uPAR/PLAUR/CD87 Protein
Produktgrößen
100 ug
£657,00
RP00653B-100UG
500 ug
£1954,00
RP00653B-500UG
1000 ug
£3382,00
RP00653B-1000UG
Über dieses Produkt
- SKU:
- RP00653B
- Zusätzliche Namen:
- CD87|MO3|PLAUR|U-PAR|uPAR
- Konjugat:
- Biotin
- Weitere Details:
- The receptor (u-PAR) for urokinase plasminogen activator (u-PA) is a three-domain protein, GPI-anchored to the cell surface, which focuses the enzymatic activity of u-PA, and allows the cell surface activation of plasminogen.Regulation of the activity of u-PA is also mediated by u-PAR.
- Formulierung:
- Biotinylated Recombinant Human uPAR/PLAUR/CD87 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Gly305) of Human uPAR/PLAUR/CD87 (Accession #
- Immunogen:
- Leu23-Gly305
- Molekulargewicht:
- 50-65 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00653B