Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein
Produktgrößen
10 ug
£145,00
RP00649-10UG
50 ug
£288,00
RP00649-50UG
500 ug
£1240,00
RP00649-500UG
1000 ug
£1954,00
RP00649-1000UG
Über dieses Produkt
- SKU:
- RP00649
- Zusätzliche Namen:
- Thymic stroma-derived lymphopoietin|Thymic stromal lymphopoietin|Tslp
- Weitere Details:
- Thymic stromal lymphopoietin (TSLP) is a protein belonging to the cytokine family, contains 140 amino acids. Itis known to play an important role in the maturation of T cell populations through activation of antigenpresenting cells. TSLP induces the release of T-cell-attracting chemokines from monocytes and, in particular,enhances the maturation of CD11c+ dendritic cells. It can induce allergic inflammation by directly activatingmast cells. TSLP is produced mainly by non-hematopoietic cells such as fibroblasts, epithelial cells and differenttypes of stromal or stromal-like cells. These cells are located in regions where TSLP activity is required.
- Formulierung:
- Recombinant Mouse Thymic stromal lymphopoietin/TSLP Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr20-Glu140) of mouse Thymic stromal lymphopoi
- Immunogen:
- Tyr20-Glu140
- Molekulargewicht:
- 60 kda
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00649
