Recombinant Human IL-27/IL-27A&IL-27B Protein
Produktgrößen
10 ug
£163,00
RP00639-10UG
20 ug
£223,00
RP00639-20UG
50 ug
£336,00
RP00639-50UG
100 ug
£508,00
RP00639-100UG
500 ug
£1478,00
RP00639-500UG
1000 ug
£2335,00
RP00639-1000UG
Über dieses Produkt
- SKU:
- RP00639
- Zusätzliche Namen:
- IL27A&IL27B,Interleukin-27 subunit alpha&Interleukin-27 subunit beta,IL-27 subunit alpha&IL-27 subunit beta,IL-27A&IL-27B
- Weitere Details:
- IL-27 protein is a member of the IL-6 superfamily, which is expressed on monocytes, endothelial cells, and dendritic cells. IL-27 protein is also referred to as the IL-12 p35-related protein, p28, is one subunit of a heterodimeric cytokine complex, and associates with another subunit EBI3 , and IL-12 p40-related protein (IL-27B). IL-27 protein is an early product of activated antigen-presenting cells and drives the rapid clonal expansion of naive CD4(+) T cells and plays a role in the early regulation of Th1 cells initiation which drives efficient adaptive immune response. IL-27 protein has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling. Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy.
- Formulierung:
- Recombinant Human IL-27/IL-27A&IL-27B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Pro243&Arg21-Lys229) of IL-27A (Accession #NP_663634.2
- Immunogen:
- Phe29-Pro243&Arg21-Lys229
- Molekulargewicht:
- 54-64 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- PRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP&RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00639