Recombinant Mouse IL-33 Protein
Produktgrößen
10 ug
£145,00
RP00618-10UG
20 ug
£193,00
RP00618-20UG
50 ug
£288,00
RP00618-50UG
100 ug
£431,00
RP00618-100UG
500 ug
£1240,00
RP00618-500UG
1000 ug
£1954,00
RP00618-1000UG
Über dieses Produkt
- SKU:
- RP00618
- Zusätzliche Namen:
- Il33, Il1f11, NF-HEV, 9230117N10Rik,IL-33
- Weitere Details:
- Mouse Interleukin 33 (IL-33) is a proinflammatory cytokine which may also regulates gene transcription inproducer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines andacts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases andinduces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and alsoleads to severe pathological changes in mucosal organs.
- Formulierung:
- Recombinant Mouse IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser109-Ile266) of mouse IL-33 (Accession #Q8BVZ5) fused with an initial Met at
- Immunogen:
- Ser109-Ile266
- Molekulargewicht:
- 18 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00618
