Recombinant HumanTNFRSF17/BCMA/CD269 Trimer Protein
Produktgrößen
100 ug
£431,00
RP00617-100UG
500 ug
£1240,00
RP00617-500UG
1000 ug
£2430,00
RP00617-1000UG
Über dieses Produkt
- SKU:
- RP00617
- Zusätzliche Namen:
- BCM|BCMA|CD269|TNFRSF13A|TNFRSF17
- Weitere Details:
- B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).
- Formulierung:
- Recombinant Human TNFRSF17/BCMA/CD269 Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of Human TNFRSF17/BCMA/CD269 Trimer (Acce
- Immunogen:
- Met1-Ala54
- Molekulargewicht:
- 30-48 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00617