Biotinylated Recombinant Human CD5 Protein
Produktgrößen
100 ug
£657,00
RP00594B-100UG
500 ug
£1954,00
RP00594B-500UG
1000 ug
£3382,00
RP00594B-1000UG
Über dieses Produkt
- SKU:
- RP00594B
- Zusätzliche Namen:
- CD5|CD5 antigen|CD5 molecule|LEU1|T1
- Konjugat:
- Biotin
- Weitere Details:
- CD5: a type I transmembrane protein found on T cells, thymocytes, and some B cells that is a ligand for CD72 and is involved in cellular activation or adhesion; expressed in B-cell chronic lymphocytic leukemia and T-cell lymphoma.
- Formulierung:
- Biotinylated Recombinant Human CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg25-Asn371) of Human CD5 (Accession #P06127) fused with a C-h
- Immunogen:
- Arg25-Asn371
- Molekulargewicht:
- 70-80 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00594B