Biotinylated Recombinant Human CD7 Protein
Produktgrößen
100 ug
£657,00
RP00588B-100UG
500 ug
£1954,00
RP00588B-500UG
1000 ug
£3382,00
RP00588B-1000UG
Über dieses Produkt
- SKU:
- RP00588B
- Zusätzliche Namen:
- CD7|CD7 molecule|GP40|LEU-9|Tp40|TP41
- Konjugat:
- Biotin
- Weitere Details:
- CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.
- Formulierung:
- Biotinylated Recombinant Human CD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Pro180) of Human CD7 (Accession #P09564) fused with a C-H
- Immunogen:
- Ala26-Pro180
- Molekulargewicht:
- 34-48 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00588B