Biotinylated Recombinant Human CD8 alpha Protein
Produktgrößen
100 ug
£657,00
RP00587B-100UG
500 ug
£1954,00
RP00587B-500UG
1000 ug
£3858,00
RP00587B-1000UG
Über dieses Produkt
- SKU:
- RP00587B
- Zusätzliche Namen:
- CD8|CD8a|CD8a molecule|Leu2|Lyt-2|MAL|OKT8 T-cell antigen|p32
- Konjugat:
- Biotin
- Weitere Details:
- CD8 alpha enhances the responses of antigen-specific CTL activated through TCR through binding MHC class I, favoring lipid raft partitioning of TCR, and inducing intracellular signaling. CD8 alpha is also found on dendritic cells and rat macrophages, but whether CD8 alpha enhances responses of a partner receptor, like TCR, to activate these cells is not known.
- Formulierung:
- Biotinylated Recombinant Human CD8 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of Human CD8 alpha (Accession #P01732-1) fu
- Immunogen:
- Ser22-Asp182
- Molekulargewicht:
- 30-38 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00587B