Recombinant Human CD3E&CD3G Protein
Produktgrößen
100 ug
£508,00
RP00582-100UG
500 ug
£1478,00
RP00582-500UG
1000 ug
£2906,00
RP00582-1000UG
Über dieses Produkt
- SKU:
- RP00582
- Zusätzliche Namen:
- CD3|CD3 epsilon&CD3 gamma|CD3e|CD3E&CD3G|CD3G|T3G
- Weitere Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Formulierung:
- Recombinant Human CD3E&CD3G/CD3 epsilon&CD3 gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126(CD3E) & Gln23-Ser116(CD3G)) of Huma
- Immunogen:
- Asp23-Asp126(CD3E) & Gln23-Ser116(CD3G)
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00582