Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein
Produktgrößen
100 ug
£395,00
RP00575-100UG
500 ug
£1157,00
RP00575-500UG
1000 ug
£2258,00
RP00575-1000UG
Über dieses Produkt
- SKU:
- RP00575
- Zusätzliche Namen:
- CD28|CD28 antigen|CD28 antigen (Tp44)|CD28 molecule|MGC138290|T-cell-specific surface glycoprotein CD28|Tp44
- Weitere Details:
- CD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is upregulated in antigen presenting cells (APCs). The CD86 expression on antigen presenting cells is constitutive. CD28 is the only B7 receptor constitutively expressed on naive T cells.
- Formulierung:
- Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Pro152) of Human/Cynomolgus/Rhesus-macaque
- Immunogen:
- Asn19-Pro152
- Molekulargewicht:
- 36-52 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00575