Biotinylated Recombinant Human TNFRSF5/CD40 Protein
Produktgrößen
100 ug
£657,00
RP00550B-100UG
500 ug
£1954,00
RP00550B-500UG
1000 ug
£3382,00
RP00550B-1000UG
Über dieses Produkt
- SKU:
- RP00550B
- Zusätzliche Namen:
- CD40|CD40 antigen|CD40 molecule|CD40L receptor|CDw40|MGC9013|TNFRSF5
- Konjugat:
- Biotin
- Weitere Details:
- CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects.CD40 molecule is a potential target for cancer immunotherapy. There are number of completed and ongoing clinical trials where agonistic anti-CD40 monoclonal antibodies are employed to activate an anti-tumor T cell response via activation of dendritic cells.
- Formulierung:
- Biotinylated Recombinant Human TNFRSF5/CD40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Arg193) of Human TNFRSF5/CD40 (Accession #P25942
- Immunogen:
- Glu21-Arg193
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00550B