Recombinant Human BST-1/CD157 Protein
Produktgrößen
20 ug
£175,00
RP00541-20UG
50 ug
£240,00
RP00541-50UG
100 ug
£336,00
RP00541-100UG
500 ug
£1002,00
RP00541-500UG
1000 ug
£1574,00
RP00541-1000UG
Über dieses Produkt
- SKU:
- RP00541
- Zusätzliche Namen:
- BST1,CD157
- Weitere Details:
- The cluster of differentiation (CD) system is a glycosyl phosphatidylinositol anchored membrane protein thatbelongs to the CD38 family.It is generally used in immunophynotyping. CD157 was discovered in a bonemarrow stromal cell line where it facilitates pre-B-cell growth. CD157 is a bifunctional ectoenzyme that exhibitsboth ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities followed with CD38. It plays a role inrheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Studieshave shown that this protein have a role in predicted to function as a cell surface receptor and animmunoregulatory molecule.
- Formulierung:
- Recombinant Human BST-1/CD157 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly29-Lys292) of human CD157/BST1/ADP-ribosyl cyclase 2/Cyclic ADP-ri
- Immunogen:
- Gly29-Lys292
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00541