Recombinant Human CD47 Protein
Produktgrößen
100 ug
£353,00
RP00531-100UG
500 ug
£1002,00
RP00531-500UG
1000 ug
£1954,00
RP00531-1000UG
Über dieses Produkt
- SKU:
- RP00531
- Zusätzliche Namen:
- CD47|CD47 glycoprotein|CD47 molecule|IAP|MER6|OA3
- Weitere Details:
- CD47 (Cluster of Differentiation 47) also known as integrin associated protein (IAP) is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPA Alpha).CD-47 acts as a don't eat me signal to macrophages of the immune system which has made it a potential therapeutic target in some cancers.
- Formulierung:
- Recombinant Human CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Pro139) of Human CD47 (Accession #Q08722-1) fused with a C-hFc tag at
- Immunogen:
- Gln19-Pro139
- Molekulargewicht:
- 55-65 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00531