Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Produktgrößen
100 ug
£395,00
RP00527-100UG
500 ug
£1157,00
RP00527-500UG
1000 ug
£2258,00
RP00527-1000UG
Über dieses Produkt
- SKU:
- RP00527
- Zusätzliche Namen:
- ?Ki-24 antigen|CD27 Ligand|CD27-L|CD27LG|CD70|CD70 molecule|TNFSF7|TNFSF7G
- Weitere Details:
- CD70, also named CD27 ligand (CD27L), is a type II transmembrane glycoprotein belonging to the TNF superfamily (TNFSF) and has been designated TNFSF7.? CD70 is a cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
- Formulierung:
- Recombinant Human CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of Human TNFSF7/CD27 Ligand/CD70 (Accession #P329
- Immunogen:
- Gln39-Pro193
- Molekulargewicht:
- 60-80 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00527