Recombinant Human CEACAM5/CEA/CD66e (323-500) Protein
Produktgrößen
100 ug
£431,00
RP00518-100UG
500 ug
£1240,00
RP00518-500UG
1000 ug
£2430,00
RP00518-1000UG
Über dieses Produkt
- SKU:
- RP00518
- Zusätzliche Namen:
- Carcinoembryonic|CD66e|CEA|CEACAM-5|CEACD66e
- Weitere Details:
- Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) was identified as a metastatic driver. CEACAM5 overproduction enriched for an epithelial gene expression pattern and facilitated tumor outgrowth at metastatic sites. Tissues from patients with metastatic breast cancer confirmed elevated levels of CEACAM5 in lung metastases relative to breast tumors, and an inverse correlation between CEACAM5 and the mesenchymal marker vimentin was demonstrated.
- Formulierung:
- Recombinant Human CEACAM5/CEA/CD66e (323-500) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro323-Leu500) of Human CEACAM5/CD66e (323-500) (Acc
- Immunogen:
- Pro323-Leu500
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- PKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAEL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00518