Recombinant Human CEACAM3/CD66d Protein
Produktgrößen
100 ug
£353,00
RP00517-100UG
500 ug
£1002,00
RP00517-500UG
1000 ug
£1954,00
RP00517-1000UG
Über dieses Produkt
- SKU:
- RP00517
- Zusätzliche Namen:
- CD66d|CEA|CEACAM3|CGM1
- Weitere Details:
- The human granulocyte-specific receptor carcinoembryonic antigen-related cell adhesion molecule (CEACAM)3 is critically involved in the opsonin-independent recognition of several bacterial pathogens. CEACAM3-mediated phagocytosis depends on the integrity of an ITAM-like sequence within the cytoplasmic domain of CEACAM3 and is characterized by rapid stimulation of the GTPase Rac.
- Formulierung:
- Recombinant Human CEACAM3/CD66d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly155) of Human CEACAM3/CD66d (Accession #P40198-1) fused w
- Immunogen:
- Lys35-Gly155
- Molekulargewicht:
- 50-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00517