Recombinant Human FAM3C Protein
Produktgrößen
10 ug
£145,00
RP00514-10UG
50 ug
£336,00
RP00514-50UG
500 ug
£2050,00
RP00514-500UG
1000 ug
£2430,00
RP00514-1000UG
Über dieses Produkt
- SKU:
- RP00514
- Zusätzliche Namen:
- FAM3C,GS3786,ILEI
- Weitere Details:
- FAM3C, also called interleukin-like EMT inducer, usually exist in most secretory epithelia. It belongs to theFAM3 family according to their sequence similarities. The up-regulation and/or mislocalization in breast cancerand liver carcinoma cells of FAM3C is strongly correlated with metastasis formation and survival. FAM3C can beinvolved in retinal laminar formation and promote epithelial to mesenchymal transition.
- Formulierung:
- Recombinant Human FAM3C Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln25-Asp227) of human FAM3C (Accession #Q92520) fused with a 6xHis tag at
- Immunogen:
- Gln25-Asp227
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00514
