Recombinant Human FABP3/H-FABP Protein
Produktgrößen
50 ug
£ POA
RP00502-50UG
10 ug
£133,00
RP00502-10UG
20 ug
£181,00
RP00502-20UG
100 ug
£353,00
RP00502-100UG
500 ug
£1002,00
RP00502-500UG
1000 ug
£1574,00
RP00502-1000UG
Über dieses Produkt
- SKU:
- RP00502
- Zusätzliche Namen:
- FABP3, FABP11, MDGI,Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Heart-type fatty acid-binding protein, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP
- Weitere Details:
- FABP3/H-FABP,FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.Fatty acid binding protein-3 is a member of a large superfamily of lipid binding proteins that are expressed in a tissue specific manner . Although all are highly conserved in their tertiary structure, there is only modest aa identity between any two members. The FABP family members are subdivided based on organ or tissue type it was originally expressed or identified; liver- (L-FABP), intestine- (I-FABP), heart- (H-FABP), adipocyte- (A-FABP), epidermal- (E-FABP), ileal- (IL-FABP), brain- (B-FABP), myelin- (M-FABP) and testis-FABP (T-FABP). Human H-FABP, the product of the FABP3 gene, is a 132 aa cytosolic protein that shows a flattened beta -barrel structure generated by a series of antiparallel beta -strands and two alpha -helices . One molecule of FABP3 is capable of binding one long-chain fatty acid . It is suggested that ligands first bind to the outside of the molecule, and this binding subsequently induces a conformational change in the binding protein, resulting in "internalization" of the ligand . Human FABP3 is 86%, 89% and 89% aa identical to mouse, rat and canine FABP3, respectively.
- Formulierung:
- Recombinant Recombinant Human FABP3/H-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val2-Ala133) of Human FABP3/H-FABP (Accession #NP_00409
- Immunogen:
- Val2-Ala133
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00502