Biotinylated Recombinant Human HER1/ERBB1/EGFR (25-378) Protein
Produktgrößen
100 ug
£657,00
RP00500B-100UG
500 ug
£1954,00
RP00500B-500UG
1000 ug
£3382,00
RP00500B-1000UG
Über dieses Produkt
- SKU:
- RP00500B
- Zusätzliche Namen:
- EC 2.7.10|EC 2.7.10.1|EGFR|ErbB|ERBB1|HER1|LEGFR|mENA|NISBD2|PIG61
- Konjugat:
- Biotin
- Weitere Details:
- The epidermal growth factor receptor (EGFR) is overexpressed in a variety of human epithelial tumors, often as a consequence of gene amplification. Tumors with EGFR gene amplification frequently contain EGFR gene rearrangements, with the most common extracellular domain mutation being EGFRvIII. This mutation leads to a deletion of exons 2-7 of the EGFR gene and renders the mutant receptor incapable of binding any known ligand.
- Formulierung:
- Biotinylated Recombinant Human ERBB1/HER1/EGFR (25-378) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ser378) of Human ERBB1/HER1/EGFR (25
- Immunogen:
- Leu25-Ser378
- Molekulargewicht:
- 60-78 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00500B