Biotinylated Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein
Produktgrößen
100 ug
£657,00
RP00481B-100UG
500 ug
£1954,00
RP00481B-500UG
1000 ug
£3382,00
RP00481B-1000UG
Über dieses Produkt
- SKU:
- RP00481B
- Zusätzliche Namen:
- CD32A|Fc gamma RIIA|FCG2|FCGR2|FCGR2A|FCGR2A1|FcgRIIA|fcRII-a|FCRIIA
- Konjugat:
- Biotin
- Weitere Details:
- The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. The CD64 proteins are high affinity receptors (10-8-10-9 M) capable of binding monomeric IgG, whereas the CD16 and CD32 proteins bind IgG with lower affinities (10-6-10-7 M) only recognizing IgG aggregates surrounding multivalent antigens.
- Formulierung:
- Biotinylated Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218) of Human Fc gamma RIIA/CD3
- Immunogen:
- Ala36-Ile218
- Molekulargewicht:
- 30-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00481B