Biotinylated Recombinant Human FcRn/FCGRT&B2M Protein
Produktgrößen
100 ug
£657,00
RP00470B-100UG
500 ug
£1954,00
RP00470B-500UG
1000 ug
£3858,00
RP00470B-1000UG
Über dieses Produkt
- SKU:
- RP00470B
- Zusätzliche Namen:
- FCGRT|FCGRT&B2M|FCRN|FcRn alpha chain
- Konjugat:
- Biotin
- Weitere Details:
- The neonatal Fc receptor (FCRN) is an approximately 45 kDa transmembrane glycoprotein with structural homology to MHC class I proteins. It is widely expressed in endothelial and epithelial cells and plays an important role in IgG homeostasis and antigen presentation by dendritic cells.FCGRT & B2M heterodimer protein (FcRn complex) consist of two subunits: p51, and p14 , and forms an MHC class I-like heterodimer.
- Formulierung:
- Biotinylated Recombinant Human FcRn/FCGRT&B2M Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser297)&(Ile21-Met119) of Human FcRn/FCGRT&B2M
- Immunogen:
- Ala24-Ser297(FCGRT) & Ile21-Met119(B2M)
- Molekulargewicht:
- 48-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00470B