Recombinant Human TNFRSF11A/RANK/CD265 Protein
Produktgrößen
10 ug
£145,00
RP00458-10UG
50 ug
£288,00
RP00458-50UG
500 ug
£1478,00
RP00458-500UG
1000 ug
£1954,00
RP00458-1000UG
Über dieses Produkt
- SKU:
- RP00458
- Zusätzliche Namen:
- TNFRSF11A,CD265,FEO,LOH18CR1,ODFR,OFE,OPTB7,OSTS,PDB2,RANK,TRANCER
- Weitere Details:
- This protein is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus.
- Formulierung:
- Recombinant Human TNFRSF11A/RANK/CD265 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ile30-Pro212) of human TNFRSF11A/RANK/CD265 (Accession #Q9Y6Q
- Immunogen:
- Ile30-Pro212
- Molekulargewicht:
- 35-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00458
