Biotinylated Recombinant Human HMGB1 Protein (Primary Amine Labeling)
Produktgrößen
100 ug
£657,00
RP00455B-100UG
500 ug
£1954,00
RP00455B-500UG
1000 ug
£3382,00
RP00455B-1000UG
Über dieses Produkt
- SKU:
- RP00455B
- Zusätzliche Namen:
- HMG-1|HMG1|HMG3|HMGB1|SBP-1
- Konjugat:
- Biotin
- Weitere Details:
- High-mobility group box 1 (HMGB1) is a ubiquitous nuclear protein that promotes inflammation when released extracellularly after cellular activation, stress, damage or death. HMGB1 operates as one of the most intriguing molecules in inflammatory disorders via recently elucidated signal and molecular transport mechanisms. Treatments based on antagonists specifically targeting extracellular HMGB1 have generated encouraging results in a wide number of experimental models of infectious and sterile inflammation.
- Formulierung:
- Biotinylated Recombinant Human HMGB1 Protein (Primary Amine Labeling) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu215) of Human HMGB1 (Primary
- Immunogen:
- Met1-Glu215
- Molekulargewicht:
- 32-36 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:RP00455B