Recombinant Human IL-1R1/CD121a Protein
Produktgrößen
100 ug
£395,00
RP00450-100UG
500 ug
£1157,00
RP00450-500UG
1000 ug
£2258,00
RP00450-1000UG
Über dieses Produkt
- SKU:
- RP00450
- Zusätzliche Namen:
- CD121a|D2S1473|IL-1 RI|IL-1R-1|IL-1R-alpha|IL-1RI|IL-1RT1|IL1R|IL1RA|IL1RI|p80
- Weitere Details:
- Interleukin 1 (IL-1) has long been known for its pleiotropic effects on inflammation that plays a complex, and sometimes contrasting, role in different stages of cancer development.IL-1R1 is the main receptor for both ligands and is expressed by various cell types, including innate and adaptive immune cell types, epithelial cells, endothelial cells, adipocytes, chondrocytes, fibroblasts, etc. IL-1 and IL-1R1 receptor interaction leads to a set of common signaling pathways, mainly the NF-kB and MAP kinase pathways, as a result of complex positive and negative regulations.
- Formulierung:
- Recombinant Human IL-1R1/ CD121a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu18-Thr332) of Human IL-1R1/ CD121a (Accession #P14778) fused w
- Immunogen:
- Leu18-Thr332
- Molekulargewicht:
- 50-65 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00450