Recombinant Human IL-3RA/CD123 Protein
Produktgrößen
100 ug
£395,00
RP00443-100UG
500 ug
£1157,00
RP00443-500UG
1000 ug
£2258,00
RP00443-1000UG
Über dieses Produkt
- SKU:
- RP00443
- Zusätzliche Namen:
- CD123|IL-3 R alpha|IL-3R subunit alpha|IL-3Ra|IL3R|IL3RA|IL3RAY|IL3RX|IL3RY|MGC34174
- Weitere Details:
- Interleukin-3 receptor subunit alpha, also known as IL-3 receptor subunit alpha, IL-3R-alpha, CD123, and IL3RA, is a single-pass type I membrane protein which belongs to the type I cytokine receptor family and Type 5 subfamily.The specific alpha subunit of the interleukin-3 receptor (IL-3Ralpha, CD123) is strongly expressed in various leukemic blasts and leukemic stem cells and seems to be an excellent target for the therapy of leukemias.
- Formulierung:
- Recombinant Human IL-3RA/CD123 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr19-Arg305) of Human IL-3 R alpha/CD123 (Accession #P26951-1) fus
- Immunogen:
- Thr19-Arg305
- Molekulargewicht:
- 70-80 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequenz:
- TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00443