Recombinant Human TROP-2/TACSTD2 Protein
Produktgrößen
100 ug
£336,00
RP00422-100UG
500 ug
£907,00
RP00422-500UG
1000 ug
£1574,00
RP00422-1000UG
Über dieses Produkt
- SKU:
- RP00422
- Zusätzliche Namen:
- EGP-1|EGP1|GA733-1|gp50|M1S1|T16|TACD2|TACSTD2|TROP-2|TROP2
- Weitere Details:
- Trop-2,also known as epithelial glycoprotein-1 antigen (EGP-1),is a protein that in humans is encoded by the TACSTD2 gene.Mutations of this gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness.
- Formulierung:
- Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Thr274) of Human TROP-2/TACSTD2 (Accession #P09758) fused w
- Immunogen:
- His27-Thr274
- Molekulargewicht:
- 60-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00422