Recombinant Human CEACAM6/CD66c Protein
Produktgrößen
100 ug
£353,00
RP00413-100UG
500 ug
£1002,00
RP00413-500UG
1000 ug
£1954,00
RP00413-1000UG
Über dieses Produkt
- SKU:
- RP00413
- Zusätzliche Namen:
- CD66c|CEA|CEACAM6|CEAL|NCA
- Weitere Details:
- Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) belongs to the human carcino-embryonic antigen (CEA) family. Numerous lines of studies have indicated that altered expression of CEACAM6 may have a role in carcinogenesis and development.
- Formulierung:
- Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of Human CEACAM6/CD66c (Accession #P40199) fused wit
- Immunogen:
- Lys35-Gly320
- Molekulargewicht:
- 55-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00413