Biotinylated Recombinant Human PVR/CD155 Protein
Produktgrößen
100 ug
£657,00
RP00389B-100UG
500 ug
£1954,00
RP00389B-500UG
1000 ug
£3382,00
RP00389B-1000UG
Über dieses Produkt
- SKU:
- RP00389B
- Zusätzliche Namen:
- CD155|FLJ25946|HVED|Necl-5|NECL5|nectin-like 5|PVR|PVS|PVSFLJ25946|Tage4
- Konjugat:
- Biotin
- Weitere Details:
- CD155 is a cell surface adhesion molecule functioning in tumor cell migration, invasion, and metastasis, and not surprisingly, is also designated as a common tumor-associated antigen. CD155 is also recognized by NK cells to induce their cytotoxicity. CD155 is also commonly referred to as the "poliovirus receptor," or PVR.
- Formulierung:
- Biotinylated Recombinant Human PVR/CD155 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Trp21-Asn343) of Human PVR/CD155 (Accession #P15151-1) fu
- Immunogen:
- Trp21-Asn343
- Molekulargewicht:
- 55-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00389B