Recombinant Human Nectin-2/PVRL2/CD112 Protein
Produktgrößen
100 ug
£336,00
RP00382-100UG
500 ug
£1002,00
RP00382-500UG
1000 ug
£1764,00
RP00382-1000UG
Über dieses Produkt
- SKU:
- RP00382
- Zusätzliche Namen:
- CD112|HVEB|MPH|Nectin2|PRR2|PVRL2|PVRR2
- Weitere Details:
- Nectin-2 is an adhesion molecule that has been reported to play a role in tumor growth, metastasis and tumor angiogenesis. Nectin-2 expression in ovarian cancer may support tumor cell adhesion, leading to growth and lymph node metastasis. Effect of VEGF on Nectin-2 expression as well as permeability was investigated in HUVEC.
- Formulierung:
- Recombinant Human Nectin-2/PVRL2/CD112 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln32-Leu360) of Human Nectin-2/PVRL2/CD112 (Accession #Q92
- Immunogen:
- Gln32-Leu360
- Molekulargewicht:
- 70-80 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00382