Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein
Produktgrößen
100 ug
£395,00
RP00360-100UG
500 ug
£1157,00
RP00360-500UG
1000 ug
£2258,00
RP00360-1000UG
Über dieses Produkt
- SKU:
- RP00360
- Zusätzliche Namen:
- 4-1BB Ligand|4-1BBL|41BB Ligand|CD137L|TNFSF9
- Weitere Details:
- The 4-1BBL is the high affinity ligand of 4-1BB, also known as CD137L or TNFSF9. 4-1BB ligand (4-1BBL) is an inducible molecule present on several APC types, including B cells, macrophages and DCs.4-1BB:4-1BBL pathway seems to amplify the existing costimulatory signals, even if the engagement of 4-1BB in the presence of a strong TCR signaling can induce IL-2 production in a CD28-independent manner.
- Formulierung:
- Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg71-Glu254) of Human TNFSF9/4-1BB Ligand Trimer (Ac
- Immunogen:
- Arg71-Glu254
- Molekulargewicht:
- 84 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00360