Recombinant Human NKp46/NCR1/CD335 Protein
Produktgrößen
100 ug
£395,00
RP00349-100UG
500 ug
£1157,00
RP00349-500UG
1000 ug
£2258,00
RP00349-1000UG
Über dieses Produkt
- SKU:
- RP00349
- Zusätzliche Namen:
- CD335|Ly94|MAR-1|NCR1|NKp46|NKP46FLJ99094
- Weitere Details:
- NKp46, along with NKp30 and NKp44, are activating receptors that have been collectively termed the natural cytotoxicity receptors (NCR).These receptors lack significant sequence homology to one another. They are expressed almost exclusively by NK cells and play a major role in triggering some of the key lytic activities of NK cells.
- Formulierung:
- Recombinant Human NKp46/NCR1/CD335 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Asn255) of Human NKp46/NCR1/CD335 (Accession #O76036-1) f
- Immunogen:
- Gln22-Asn255
- Molekulargewicht:
- 65-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00349