Recombinant Human DNAM-1/CD226 Protein
Produktgrößen
100 ug
£336,00
RP00335-100UG
500 ug
£1002,00
RP00335-500UG
1000 ug
£1764,00
RP00335-1000UG
Über dieses Produkt
- SKU:
- RP00335
- Zusätzliche Namen:
- CD226|CD226 molecule|DNAM1|PTA1|TLiSA1
- Weitere Details:
- DNAX accessory molecule-1 (DNAM-1), also known as CD226, is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily.DNAM-1 mediates cellular adhesion to other cells bearing its ligands, CD112 and CD155, and cross-linking DNAM-1 with antibodies causes cellular activation. Furthermore, DNAM-1 can interact with PVR and PVRL2.
- Formulierung:
- Recombinant Human DNAM-1/CD226 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Asn247) of Human DNAM-1/CD226 (Accession #Q15762) fused with
- Immunogen:
- Glu19-Asn247
- Molekulargewicht:
- 70-100 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00335