Recombinant Human B7-H1/PD-L1/CD274 Protein
Produktgrößen
100 ug
£353,00
RP00327-100UG
500 ug
£1002,00
RP00327-500UG
1000 ug
£1954,00
RP00327-1000UG
Über dieses Produkt
- SKU:
- RP00327
- Zusätzliche Namen:
- B7-H|B7-H1|B7H1|CD274|PD-L1|PD-L1B7 homolog 1|PDCD1L1|PDCD1LG1|PDL1
- Weitere Details:
- B7-H1, also known as PD-L1 and CD274, is an approximately 65 kDa transmembrane glycoprotein in the B7 family of immune regulatory molecules. PD-L1 has been identified as the ligand for the immunoinhibitory receptor programmed death-1(PD1/PDCD1) and has been demonstrated to play a role in the regulation of immune responses and peripheral tolerance.
- Formulierung:
- Recombinant Human PD-L1/B7-H1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe19-Ile226) of Human PD-L1/B7-H1 (Accession #Q9NZQ7-1) fused with
- Immunogen:
- Phe19-Ile226
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00327