Recombinant Human CCL24/Eotaxin-2 Protein
Produktgrößen
10 ug
£145,00
RP00318-10UG
20 ug
£193,00
RP00318-20UG
50 ug
£288,00
RP00318-50UG
100 ug
£431,00
RP00318-100UG
500 ug
£1240,00
RP00318-500UG
1000 ug
£1954,00
RP00318-1000UG
Über dieses Produkt
- SKU:
- RP00318
- Zusätzliche Namen:
- CCL24,Ckb-6,MPIF-2,MPIF2,SCYA24
- Weitere Details:
- Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line.
- Formulierung:
- Recombinant Human CCL24/Eotaxin-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val27-Cys119) of human CCL24/Eotaxin-2 (Accession #O00175) fused with
- Immunogen:
- Val27-Cys119
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00318