Recombinant Human SLAMF7/CRACC/CD319 Protein
Produktgrößen
100 ug
£336,00
RP00305-100UG
500 ug
£907,00
RP00305-500UG
1000 ug
£1574,00
RP00305-1000UG
Über dieses Produkt
- SKU:
- RP00305
- Zusätzliche Namen:
- 19A|CD2 subset 1|CD319|CRACC|CS1|FOAP-12|Novel Ly9|SLAMF7
- Weitere Details:
- CD2-like receptor activating cytotoxic cells (CRACC), also known as CS1, novel Ly9, SLAMF7, and CD319, is a 65-75 kDa type I transmembrane glycoprotein in the SLAM subgroup of the CD2 family.Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response.
- Formulierung:
- Recombinant Human SLAMF7/CRACC/CD319 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser23-Met226) of Human SLAMF7/CRACC/CD319 (Accession #Q9NQ25-
- Immunogen:
- Ser23-Met226
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00305