Recombinant Human SLAMF7/CRACC/CD319 Protein
Produktgrößen
20 ug
£157,00
RP00292-20UG
50 ug
£223,00
RP00292-50UG
100 ug
£336,00
RP00292-100UG
500 ug
£907,00
RP00292-500UG
1000 ug
£1478,00
RP00292-1000UG
Über dieses Produkt
- SKU:
- RP00292
- Zusätzliche Namen:
- SLAMF7,19A,CD319,CRACC,CS1
- Weitere Details:
- SLAM family member 7 (SLAMF7), also known as CRACC, CD319, CD2-like receptor-activating cytotoxic cells, and CS1, is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells but not in promyelocytic, B-cell lines, or T-cell lines. In human NK cells, activated SLAMF7 transmits signals following association with the adaptor protein EAT-2 . In the absence of EAT-2, SLAMF7 potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.
- Formulierung:
- Recombinant Human SLAMF7/CRACC/CD319 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser23-Met226) of human SLAMF7/CD319 (Accession #NP_067004.3) fused
- Immunogen:
- Ser23-Met226
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00292

